PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_29749
Common NameKK1_030560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family Nin-like
Protein Properties Length: 862aa    MW: 95953.2 Da    PI: 6.121
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_29749genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.33.5e-29565616152
         RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    aek+i+l++l++yF++++kdAAk++gvc+T+LKriCRq+GIkRWP+Rkik++
  C.cajan_29749 565 AEKTITLQVLRQYFAGSLKDAAKNIGVCTTTLKRICRQHGIKRWPSRKIKKV 616
                    589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.403.6E-4196280IPR029016GAF domain-like
PROSITE profilePS5151917.666555636IPR003035RWP-RK domain
PfamPF020426.0E-25568616IPR003035RWP-RK domain
SuperFamilySSF542775.89E-24767853No hitNo description
Gene3DG3DSA:3.10.20.2409.7E-22768848No hitNo description
PROSITE profilePS5174524.71768851IPR000270PB1 domain
SMARTSM006663.9E-22768851IPR000270PB1 domain
PfamPF005641.1E-17769849IPR000270PB1 domain
CDDcd064071.08E-43769850No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 862 aa     Download sequence    Send to blast
MMEAPPPDGT TSMDFEYMGE LFLDGCWLEA SADGSEFLLQ SPSFSNSLFD PSFSWPALET  60
NHNESHDAAF GTQQESHNSM VNIVSGGGGG SGMQFQFDAH SVEGASEGVK RWWFAPTPSP  120
GPGPSITEKL LRALTWFKDY NRNKDMLIQI WVPVHRGGRP ILAANDLLFS LESRSVNLAK  180
YREISVGYEF STDEGESKEL VPGLPGRVFR NKVPEWTPDV RFFKSDEYPR VDHAQEYDVS  240
GTLAVPIFEQ GSKMCLGVIE VVMTTQQINY GPELESVCKA LEAVDLRSSK HSNIQIVKAC  300
NRSYDAALPE IQEVLRSACE MHNLPLAQTW IPCVQQGKEG CRHSDDNYLL CISPVEQACY  360
VRDPSIRPFH EACTEHHLLK GEGVAGGAFM TNQPCFSTDI TSLSKKDYPL SHHARLLGLR  420
AAVAIRLRSI YNSTDDFVLE FFLPVDCNDS EEQRKMLTSL SIIIQRVCCS LRVISDKELE  480
EANLSVDEVI GLADSGVSRT AICSGLQQKE KSSETMCRKF SDLRQQENPI LKGNLDCVRE  540
CSTSVEGNFS GAGISRTVER RRAKAEKTIT LQVLRQYFAG SLKDAAKNIG VCTTTLKRIC  600
RQHGIKRWPS RKIKKVGHSL QKLQLVIDSV QGASGAFQID SFYSNFPDLA SPNLSGTSLF  660
STLNQADNPN SVSTQPEPGA LSPEGASKSP SSSCSQKLQH HTNNKDPAVG EDSADVVLKR  720
IRSEAELKSL SRDGTKLLPR SQSQETLGEH PITQYHRPLL KTSSKVDAHR VKVTYGDEKT  780
RFRMLKSWGY EDLLQEIARR FNVSDMRKFD VKYLDDDCEW VLLTCDADLE ECIDVCQSSE  840
SSTIKLCLHA SSHSMRSSLE FR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00154DAPTransfer from AT1G20640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2353870.0AC235387.1 Glycine max strain Williams 82 clone GM_WBb0115J10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136019.10.0hypothetical protein PHAVU_009G011200g
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A151RZ220.0A0A151RZ22_CAJCA; Uncharacterized protein
STRINGGLYMA06G02030.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein